MKNK2 Rabbit Polyclonal Antibody

• Catalog Number: orb582724
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MKNK2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MKNK2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 52 kDa
• Target: MKNK2
• UniProt ID: Q9HBH9
• Protein Sequence: Synthetic peptide located within the following region: SDFGLQCSARPDMPASQPIDIPDAKKRGKKKKRGRATDSFSGRFEDVYQL
• NCBI: NP_951009
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: MNK2, GPRK7
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. An isoform containing the peptide sequence is also present at 46 kDa.

Positive control (+): Human brain (BR), Negative control (-): Human lung (LU), Antibody concentration: 1 ug/ml.

Human Spleen

Immunohistochemistry with Human Placenta lysate tissue at an antibody concentration of 5.0 ug/ml using anti-MKNK2 antibody (orb582724).

WB Suggested Anti-MKNK2 Antibody Titration: 1 ug/ml, Positive Control: 721_B cell lysate. MKNK2 is supported by BioGPS gene expression data to be expressed in 721_B.