MKL1 Rabbit Polyclonal Antibody

• Catalog Number: orb576329
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MKL1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat, Zebrafish
• Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 106kDa
• Target: MKL1
• UniProt ID: Q8K4J6
• Protein Sequence: Synthetic peptide located within the following region: QPLSQPGFPAPGPPAQMDLEHPPQPPFATPTSLLKKEPPGYEETVTQQPK
• NCBI: NP_694629
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: M, Bs, Mal, Mkl, AMKL, Bsac, MRTF, Mkl1, Mrtf-A
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Spleen, Antibody Dilution: 1.0 ug/ml.

WB Suggested Anti-MKL1 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:1562500, Positive Control: NIH/3T3 cell lysate.