You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb576329 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to MKL1 |
| Target | MKL1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Immunogen | The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Protein Sequence | Synthetic peptide located within the following region: QPLSQPGFPAPGPPAQMDLEHPPQPPFATPTSLLKKEPPGYEETVTQQPK |
| UniProt ID | Q8K4J6 |
| MW | 106kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | M, Bs, Mal, Mkl, AMKL, Bsac, MRTF, Mkl1, Mrtf-A |
| Research Area | Cancer Biology, Epigenetics & Chromatin, Signal Tr Read more... |
| Note | For research use only |
| NCBI | NP_694629 |

Sample Tissue: Mouse Spleen, Antibody Dilution: 1.0 ug/ml.

WB Suggested Anti-MKL1 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:1562500, Positive Control: NIH/3T3 cell lysate.
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review