You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb325235 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MIS18A |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human C21orf45 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 26kDa |
Target | MIS18A |
UniProt ID | Q9NYP9 |
Protein Sequence | Synthetic peptide located within the following region: MAGVRSLRCSRGCAGGCECGDKGKCSDSSLLGKRLSEDSSRHQLLQKWAS |
NCBI | NP_061817 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti B28 antibody, anti C21orf46 antibody, anti FA Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-C21orf45 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: NCI-H226 cell lysate.
ELISA, FC, ICC, IF, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, WB | |
Canine, Equine, Mouse, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
Biotin |
ELISA, WB | |
Canine, Equine, Mouse, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
HRP |
Filter by Rating