Cart summary

You have no items in your shopping cart.

MIGA2 Rabbit Polyclonal Antibody (Biotin)

MIGA2 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2086492

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2086492
CategoryAntibodies
DescriptionMIGA2 Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human FAM73B
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW38kDa
UniProt IDQ7L4E1
Protein SequenceSynthetic peptide located within the following region: RRKKQVGPEMGGEQLGTVPLPILLARKVPSVKKGYSSRRVQSPSSKSNDT
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesFAM73B, C9orf54
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.