Cart summary

You have no items in your shopping cart.

MIGA1 Rabbit Polyclonal Antibody (HRP)

MIGA1 Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2088350

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2088350
CategoryAntibodies
DescriptionMIGA1 Rabbit Polyclonal Antibody (HRP)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human FAM73A
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ConjugationHRP
MW42kDa
UniProt IDQ8NAN2
Protein SequenceSynthetic peptide located within the following region: SRQNLTLSLSSTKDKGSQVCNYANGGLFSKYSGSAQSLASVQSVNSCHSC
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Alternative namesFAM73A
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.