You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb587751 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MIEF2 |
Target | MIEF2 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human SMCR7 |
Protein Sequence | Synthetic peptide located within the following region: IDRATSPRDEDDTKADSWKELSLLKATPHLQPRPPPAALSQPVLPLAPSS |
UniProt ID | Q96C03 |
MW | 22kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | MID49, SMCR7, COXPD49 |
Research Area | Cell Biology |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: MCF7 Whole Cell lysates, Antibody Dilution: 1.0 ug/ml.
WB | |
Equine, Guinea pig, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, ICC, IF, IHC-Fr, IHC-P | |
Bovine, Canine | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Human, Rabbit, Sheep | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |