Cart summary

You have no items in your shopping cart.

MFSD4B Rabbit Polyclonal Antibody (HRP)

MFSD4B Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2088227

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2088227
CategoryAntibodies
DescriptionMFSD4B Rabbit Polyclonal Antibody (HRP)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Human
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human KIAA1919
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ConjugationHRP
MW57kDa
UniProt IDQ5TF39
Protein SequenceSynthetic peptide located within the following region: YAVIGTYMFLVSVIFFCLFLKNSSKQEKARASAETFRRAKYHNALLCLLF
NCBINP_699200
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Alternative namesNaGLT1, SLC60A2, KIAA1919
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.