MFSD2A Rabbit Polyclonal Antibody

• Catalog Number: orb580984
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MFSD2A
• Target: MFSD2A
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human MFSD2A
• Protein Sequence: Synthetic peptide located within the following region: MFISTEQTERDSATAYRMTVEVLGTVLGTAIQGQIVGQADTPCFQDLNSS
• UniProt ID: E7EPI8
• MW: 60 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: NLS1, MFSD2, MCPH15, SLC59A1, NEDMISBA
• Note: For research use only
• NCBI: NP_001274737.1

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Recommended dilution for antibody is 1-3 ug/ml. Recognizes several isoforms from 341 amino acids (38 kDa) to 530 amino acids (58 kDa).

Sample Type: Thyroid Tumor lysates, Antibody dilution: 1.0 ug/ml.

Positive control (+): Human lung (LU), Negative control (-): HepG2 (HG), Antibody concentration: 1 ug/ml.