You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb583674 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to MFN1 |
| Target | MFN1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human, Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Porcine, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human MFN1 |
| Protein Sequence | Synthetic peptide located within the following region: QVDITQKQLEEEIARLPKEIDQLEKIQNNSKLLRNKAVQLENELENFTKQ |
| UniProt ID | Q8R4Z9 |
| MW | 84 kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | hfzo1, hfzo2 |
| Research Area | Cell Biology, Protein Biochemistry, Stem Cell & De Read more... |
| Note | For research use only |
| NCBI | NP_284941 |

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. In addition to the ~84 kDa protein, a 40 kDa isoform also contains this peptide sequence.

Sample Tissue: Mouse Kidney, Antibody dilution: 1 ug/ml.

WB Suggested Anti-MFN1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Placenta.
FC | |
Equine, Human, Mouse, Rabbit | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Porcine, Rabbit, Rat, Zebrafish | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC | |
Equine, Human, Mouse, Rabbit | |
Rat | |
Rabbit | |
Polyclonal | |
Cy3 |
FC | |
Equine, Human, Mouse, Rabbit | |
Rat | |
Rabbit | |
Polyclonal | |
APC |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review