MFN1 Rabbit Polyclonal Antibody

• Catalog Number: orb583674
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MFN1
• Target: MFN1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MFN1
• Protein Sequence: Synthetic peptide located within the following region: QVDITQKQLEEEIARLPKEIDQLEKIQNNSKLLRNKAVQLENELENFTKQ
• UniProt ID: Q8R4Z9
• MW: 84 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: hfzo1, hfzo2
• Research Area: Cell Biology, Protein Biochemistry, Stem Cell & De
• Note: For research use only
• NCBI: NP_284941

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. In addition to the ~84 kDa protein, a 40 kDa isoform also contains this peptide sequence.

Sample Tissue: Mouse Kidney, Antibody dilution: 1 ug/ml.

WB Suggested Anti-MFN1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Placenta.