Cart summary

You have no items in your shopping cart.

Mfap1a Rabbit Polyclonal Antibody (FITC)

Mfap1a Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2102997

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2102997
CategoryAntibodies
DescriptionMfap1a Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Protein SequenceSynthetic peptide located within the following region: QFIKKAKEQEAEPEEQEEDSSSDPRLRRLQNRISEDVEERLARHRKIVEP
UniProt IDQ9CQU1
MW52kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesMfa, Mfap1, Mfap1b, 4432409M24Rik
NoteFor research use only
NCBINP_080496