Cart summary

You have no items in your shopping cart.

METTL6 Rabbit Polyclonal Antibody (Biotin)

METTL6 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2113546

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2113546
CategoryAntibodies
DescriptionMETTL6 Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human METTL6
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW33kDa
UniProt IDQ8TCB7
Protein SequenceSynthetic peptide located within the following region: QKLEQEAQKNWDLFYKRNSTNFFKDRHWTTREFEELRSCREFEDQKLTML
NCBINP_689609
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesMGC24132
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.