METAP2 Rabbit Polyclonal Antibody

• Catalog Number: orb581642
• Category: Antibodies
• Description: Rabbit polyclonal antibody to METAP2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human METAP2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 53kDa
• Target: METAP2
• UniProt ID: P50579
• Protein Sequence: Synthetic peptide located within the following region: ATGKKKKKKKKKRGPKVQTDPPSVPICDLYPNGVFPKGQECEYPPTQDGR
• NCBI: NP_006829
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: MAP2, MNPEP, p67eIF2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml. METAP2 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.

Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. METAP2 Antibody (orb581642) concentration is 5 ug/ml.

WB Suggested Anti-METAP2 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human brain.