MELTF Rabbit Polyclonal Antibody

• Catalog Number: orb584644
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MELTF
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IF, WB
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MFI2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 78kDa
• Target: MELTF
• UniProt ID: P08582
• Protein Sequence: Synthetic peptide located within the following region: CVPVNNPKNYPSSLCALCVGDEQGRNKCVGNSQERYYGYRGAFRCLVENA
• NCBI: NP_005920
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: MTf, MFI2, MTF1, CD228, MAP97
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: HeLa cells, Primary Antibody dilution: 1:50, Secondary Antibody: Goat anti-rabbit-Alexa Fluor 488, Secondary Antibody dilution: 1:800, Color/Signal Descriptions: Green: MFI2 Blue: DAPI, Gene Name: MFI2.

WB Suggested Anti-MFI2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.