MED25 Rabbit Polyclonal Antibody

• Catalog Number: orb581181
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MED25
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ChIP, WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Porcine, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MED25
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 78 kDa
• Target: MED25
• UniProt ID: Q71SY5
• Protein Sequence: Synthetic peptide located within the following region: EGLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCAPESYV
• NCBI: NP_112235
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: P78, ACID1, ARC92, BVSYS, PTOV2, CMT2B2, TCBAP0758
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The peptide is present in isoforms of 87, 84, 78, 76 and 59 kDa but is absent from the canonical isoform of 90 kDa.

Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.

WB Suggested Anti-MED25 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human heart.