MEAK7 Rabbit Polyclonal Antibody

• Catalog Number: orb583589
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MEAK7
• Target: MEAK7
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIAA1609
• Protein Sequence: Synthetic peptide located within the following region: LSAQENFQFDKMEVWAVGDPSEEQLAKGNKSILDADPEAQALLEISGHSR
• UniProt ID: Q6P9B6
• MW: 51kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: TLDC1, mEAK-7, KIAA1609
• Research Area: Epigenetics
• Note: For research use only
• NCBI: NP_065998

Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-KIAA1609 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Transfected 293T.