FLJ11730 Rabbit Polyclonal Antibody

SKU: orb324473

Description

FLJ11730 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of MEAF6. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human FLJ11730. This antibody reacts with Human samples and is predicted to react with Bovine, Mouse, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin, Protein Biochemistry

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Mouse, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FLJ11730
• Target: MEAF6
• Protein Sequence: Synthetic peptide located within the following region: HNKAAPPQIPDTRRELAELVKRKQELAETLANLERQIYAFEGSYLEDTQM
• Molecular Weight: 23kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti Eaf6 antibody, anti CENP-28 antibody, anti C1orf149 antibody, anti CDABP0189 antibody, anti NY-SAR-91 antibody, anti RP3-423B22.2 antibody, anti FLJ11730 antibody

Quick Database Links

Gene Symbol

MEAF6

UniProt

Q86WE3

RefSeq (Protein):NP_073593