MCTP1 Rabbit Polyclonal Antibody

SKU: orb579175

Description

Rabbit polyclonal antibody to MCTP1

Research Area

Cell Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MCTP1
• Target: MCTP1
• Protein Sequence: Synthetic peptide located within the following region: LVWGINKFTKKLRSPYAIDNNELLDFLSRVPSDVQVVQYQELKPDPSHSP
• Molecular Weight: 112 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

FLJ22344

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Multiple isoforms of this protein contain the peptide immunogen, and isoforms of 112 kDa, 90 kDa, 79 kDa, 60 kDa, and others may be observed depending upon the sample type.

Anti-MCTP1 antibody IHC staining of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Rabbit Anti-MCTP1 Antibody, Paraffin Embedded Tissue: Human Spleen, Antibody Concentration: 5 ug/ml.

WB Suggested Anti-MCTP1 Antibody Titration: 1 ug/ml, Positive Control: Hela cell lysate.

Quick Database Links

Gene Symbol

MCTP1

UniProt

Q6DN14

RefSeq (Protein):NP_001002796