MCTP1 Rabbit Polyclonal Antibody

• Catalog Number: orb579175
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MCTP1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MCTP1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 112 kDa
• Target: MCTP1
• UniProt ID: Q6DN14
• Protein Sequence: Synthetic peptide located within the following region: LVWGINKFTKKLRSPYAIDNNELLDFLSRVPSDVQVVQYQELKPDPSHSP
• NCBI: NP_001002796
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: FLJ22344
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Multiple isoforms of this protein contain the peptide immunogen, and isoforms of 112 kDa, 90 kDa, 79 kDa, 60 kDa, and others may be observed depending upon the sample type.

Anti-MCTP1 antibody IHC staining of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Rabbit Anti-MCTP1 Antibody, Paraffin Embedded Tissue: Human Spleen, Antibody Concentration: 5 ug/ml.

WB Suggested Anti-MCTP1 Antibody Titration: 1 ug/ml, Positive Control: Hela cell lysate.