You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb575440 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MCOLN1 |
Target | MCOLN1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human MCOLN1 |
Protein Sequence | Synthetic peptide located within the following region: FRHLFLLGYSDGADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYV |
UniProt ID | Q9GZU1 |
MW | 64 kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | ML1, ML4, MG-2, MLIV, MST080, TRPML1, MSTP080, TRP Read more... |
Note | For research use only |
NCBI | NP_065394 |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. MCOLN1 can be glycosylated among other modifications.
Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 1 ug/ml.
Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 1 ug/ml.
Sample Tissue: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.
Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 1 ug/ml.
Positive control (+): Human Placenta (PL), Negative control (-): Human liver (LI), Antibody concentration: 1 ug/ml.
WB Suggested Anti-MCOLN1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate.
ELISA, ICC, IF, IHC-Fr, IHC-P | |
Bovine, Feline, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, ICC, IF, IHC-Fr, IHC-P | |
Bovine, Feline, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Sheep | |
Rabbit | |
Polyclonal | |
Biotin |
ICC, IF | |
Bovine, Feline, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Sheep | |
Rabbit | |
Polyclonal | |
FITC |
ICC, IF | |
Bovine, Feline, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Sheep | |
Rabbit | |
Polyclonal | |
PE |