MCM7 Rabbit Polyclonal Antibody

• Catalog Number: orb576051
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MCM7
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Equine, Guinea pig, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MCM7
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 81kDa
• Target: MCM7
• UniProt ID: P33993
• Protein Sequence: Synthetic peptide located within the following region: HRIVKMNKSEDDESGAGELTREELRQIAEEDFYEKLAASIAPEIYGHEDV
• NCBI: NP_005907
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: MCM2, CDC47, P85MCM, P1CDC47, PNAS146, PPP1R104, P
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Human kidney

WB Suggested Anti-MCM7 Antibody Titration: 1.25 ug/ml, Positive Control: Daudi cell lysate. MCM7 is strongly supported by BioGPS gene expression data to be expressed in Human Daudi cells.