mClover Antibody

SKU: orb1463265

Description

Goat polyclonal antibody to mClover (Clover fluorescent protein). mClover is a basic (constitutively fluorescent), monomeric engineered derivate of green fluorescent protein (GFP) isolated from Aequorea victoria

Images & Validation

• Tested Applications: IEM, IF, IHC-Fr, IHC-P, WB
• Dilution Range: WB 1:500-1:5,000, IHC 1:50-1:500, 1:50-1:500, IEM 1:50-1:500
• Application Notes:
  In 293HEK cells transfected with cds plasmid detects a band of 27 kDa by Western blot. This antibody does not recognize RFP (red fluorescent protein)

Key Properties

• Antibody Type: Primary Antibody
• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
• Target: Green Fluorescent Protein
• Purity: This antibody is epitope-affinity purified from goat antiserum
• Purification: Epitope affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: For continuous use, store at 2-8 C for one to two days. For extended storage, store in a -20 C freezer. Working dilution samples should be discarded if not used within 12 hours
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Concentration: 1 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

green fluorescent protein antibody

Anti-mClover Ab at 1/2500 dilution using HEK293 transfected cell lysates at 50 µg per lane

Anti-mClover Ab using NIH3T3 cells transduced with mClover-Rab5a the cells were fixed with methanol and anti-mClover at 1/250

Quick Database Links

Gene Symbol

Green Fluorescent Protein