mClover antibody

• Catalog Number: orb1463265
• Category: Antibodies
• Description: Goat polyclonal antibody to mClover (Clover fluorescent protein). mClover is a basic (constitutively fluorescent), monomeric engineered derivate of green fluorescent protein (GFP) isolated from Aequorea victoria
• Species/Host: Goat
• Clonality: Polyclonal
• Tested applications: IEM, IF, IHC-Fr, IHC-P, WB
• Isotype: IgG
• Immunogen: MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
• Concentration: 1mg/ml
• Dilution range: WB 1:500-1:5,000, IHC 1:50-1:500, 1:50-1:500, IEM 1:50-1:500
• Form/Appearance: Liquid solution
• Purity: This antibody is epitope-affinity purified from goat antiserum
• Conjugation: Unconjugated
• Target: mClover
• Storage: For continuous use, store at 2-8 C for one to two days. For extended storage, store in a -20 C freezer. Working dilution samples should be discarded if not used within 12 hours
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Alternative names: green fluorescent protein antibody
• Note: For research use only
• Application notes: In 293HEK cells transfected with cds plasmid detects a band of 27 kDa by Western blot. This antibody does not recognize RFP (red fluorescent protein)
• Expiration Date: 12 months from date of receipt.

Anti-mClover Ab at 1/2500 dilution using HEK293 transfected cell lysates at 50 µg per lane

Anti-mClover Ab using NIH3T3 cells transduced with mClover-Rab5a the cells were fixed with methanol and anti-mClover at 1/250