LENG4 Rabbit Polyclonal Antibody

• Catalog Number: orb580876
• Category: Antibodies
• Description: Rabbit polyclonal antibody to LENG4
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human LENG4
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 53kDa
• Target: MBOAT7
• UniProt ID: Q96N66
• Protein Sequence: Synthetic peptide located within the following region: WWLAQYIYKSAPARSYVLRSAWTMLLSAYWHGLHPGYYLSFLTIPLCLAA
• NCBI: NP_077274
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: BB1, LRC4, LENG4, LPIAT, LPLAT, MBOA7, MRT57, OACT
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Positive control (+): 293T (2T), Negative control (-): Human heart (HE), Antibody concentration: 3 ug/ml.

WB Suggested Anti-LENG4 Antibody Titration: 1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human brain.