MBNL1 Rabbit Polyclonal Antibody

• Catalog Number: orb330163
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MBNL1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MBNL1
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 37kDa
• Target: MBNL1
• UniProt ID: Q86UV9
• Protein Sequence: Synthetic peptide located within the following region: LCPQQQHLPQVFPSLQQPQPTSPILDASTLLGATSCPAAAAGKMIPIISA
• NCBI: NP_997179
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti EXP antibody, anti MBNL antibody, anti EXP35
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-MBNL1 Antibody, Catalog Number: orb330163, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, nucleus, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.

WB Suggested Anti-MBNL1 Antibody Titration: 2.5 ug/mL, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate, MBNL1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.