Cart summary

You have no items in your shopping cart.

MBNL1 Rabbit Polyclonal Antibody (FITC)

MBNL1 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2124135

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2124135
CategoryAntibodies
DescriptionMBNL1 Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityCanine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human MBNL1
Protein SequenceSynthetic peptide located within the following region: AMTQSAVKSLKRPLEATFDLGIPQAVLPPLPKRPALEKTNGATAVFNTGI
UniProt IDQ86VM6
MW38kDa
Tested applicationsIHC, WB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesEXP, MBNL
NoteFor research use only
NCBIAAH50535