MBD4 antibody

• Catalog Number: orb329796
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MBD4
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ChIP, WB
• Predicted Reactivity: Guinea pig, Human
• Reactivity: Guinea pig, Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MBD4
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 66kDa
• Target: MBD4
• UniProt ID: O95243
• Protein Sequence: Synthetic peptide located within the following region: CSEQKTSGIINKFCSAKDSEHNEKYEDTFLESEEIGTKVEVVERKEHLHT
• NCBI: NP_003916
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti MED1 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of HCT116 tissue using MBD4 antibody

Western blot analysis of Hela cell lysate tissue using MBD4 antibody