You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329796 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MBD4 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | ChIP, WB |
Predicted Reactivity | Guinea pig |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human MBD4 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 66kDa |
Target | MBD4 |
UniProt ID | O95243 |
Protein Sequence | Synthetic peptide located within the following region: CSEQKTSGIINKFCSAKDSEHNEKYEDTFLESEEIGTKVEVVERKEHLHT |
NCBI | NP_003916 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti MED1 antibody Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.
WB Suggested Anti-MBD4 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: Hela cell lysate, MBD4 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.
WB | |
Bovine, Mouse, Porcine, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |