MAZ Rabbit Polyclonal Antibody

• Catalog Number: orb576546
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MAZ
• Target: MAZ
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Porcine, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MAZ
• Protein Sequence: Synthetic peptide located within the following region: FPVFPCTLLAPPFPVLGLDSRGVGGLMNSFPPPQGHAQNPLQVGAELQSR
• UniProt ID: P56270
• MW: 49 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: PUR1, ZF87, Pur-1, SAF-1, SAF-2, SAF-3, Zif87, ZNF
• Note: For research use only
• NCBI: NP_002374

Sample Tissue: Mouse Spleen, Antibody Dilution: 1 ug/ml.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Positive control (+): Hela (HL), Negative control (-): Human kidney (KI), Antibody concentration: 1 ug/ml.

Human Breast

WB Suggested Anti-MAZ Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate. MAZ is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.