You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb325971 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to MAU2 |
| Target | MAU2 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human KIAA0892 |
| Protein Sequence | Synthetic peptide located within the following region: MHQNFSQQLLQDHIEACSLPEHNLITWTDGPPPVQFQAQNGPNTSLASLL |
| UniProt ID | Q9Y6X3 |
| MW | 69 kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti MAU2L antibody, anti MGC75361 antibody, anti Read more... |
| Note | For research use only |
| NCBI | NP_056144 |

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Recommended dilution for antibody is 1-3 ug/mL.

WB Suggested Anti-KIAA0892 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: MCF7 cell lysate, There is BioGPS gene expression data showing that MAU2 is expressed in MCF7.
ELISA, ICC, IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF | |
Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
APC |
ICC, IF | |
Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
APC/Cy5.5 |
ICC, IF | |
Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
APC/Cy7 |
ICC, IF | |
Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
BF350 |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review