MATR3 Rabbit Polyclonal Antibody

• Catalog Number: orb577833
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MATR3
• Target: MATR3
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MATR3
• Protein Sequence: Synthetic peptide located within the following region: ADDPNKDTSENADGQSDENKDDYTIPDEYRIGPYQPNVPVGIDYVIPKTG
• UniProt ID: P43243
• MW: 94kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: MPD2, ALS21, VCPDM
• Research Area: Epigenetics & Chromatin, Molecular Biology
• Note: For research use only
• NCBI: NP_061322
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-MATR3 Antibody Titration: 2.5 ug/ml, Positive Control: HepG2 cell lysate.