You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb579696 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to MAT2A |
| Target | MAT2A |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human MAT2A |
| Protein Sequence | Synthetic peptide located within the following region: LLEIVKKNFDLRPGVIVRDLDLKKPIYQRTAAYGHFGRDSFPWEVPKKLK |
| UniProt ID | P31153 |
| MW | 44 kDa |
| Tested applications | IHC-P, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | MATA2, MATII, SAMS2 |
| Research Area | Epigenetics & Chromatin |
| Note | For research use only |
| NCBI | NP_005902 |
| Expiration Date | 12 months from date of receipt. |

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment. Multiple isoforms of this protein from 35-47 kDa contain this peptide sequence.

Rabbit Anti-MAT2A antibody, Formalin Fixed Paraffin Embedded Tissue: Human Colon, Primary antibody Concentration: 1:200, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

Rabbit Anti-MAT2A antibody, Formalin Fixed Paraffin Embedded Tissue: Human Prostate, Primary antibody Concentration: 1:200, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-MAT2A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Hela cell lysate. MAT2A is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.
ELISA, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Gallus, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
HRP |
IF | |
Bovine, Canine, Gallus, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
Cy5.5 |
IF | |
Bovine, Canine, Gallus, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
Cy7 |
IF | |
Bovine, Canine, Gallus, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
RBITC |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review