Mapre1 Rabbit Polyclonal Antibody

• Catalog Number: orb585105
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Mapre1
• Target: Mapre1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Human, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Protein Sequence: Synthetic peptide located within the following region: GKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY
• UniProt ID: Q61166
• MW: 30kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: BIM, Eb1, BIM1p, AI462499, AI504412, AW260097, D2E
• Research Area: Cell Biology, Molecular Biology
• Note: For research use only
• NCBI: NP_031922
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-Mapre1 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Spleen.