You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb583160 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MAPK13 |
Target | MAPK13 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Porcine, Rabbit, Rat, Sheep, Yeast, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human MAPK13 |
Protein Sequence | Synthetic peptide located within the following region: EMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQ |
UniProt ID | Q9N272 |
MW | 42kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | SAPK4, PRKM13, MAPK 13, MAPK-13, p38delta |
Note | For research use only |
NCBI | NP_002745 |
Sample Tissue: Mouse Heart, Antibody dilution: 1 ug/ml.
WB Suggested Anti-MAPK13 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate.
IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Mouse, Other, Zebrafish | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |