MAP4K4 Rabbit Polyclonal Antibody

• Catalog Number: orb580624
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MAP4K4
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MAP4K4
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 142kDa
• Target: MAP4K4
• UniProt ID: O95819
• Protein Sequence: Synthetic peptide located within the following region: PFIRDQPNERQVRIQLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQ
• NCBI: NP_004825
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: HGK, NIK, MEKKK4, FLH21957, HEL-S-31
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human Stomach Tumor, Antibody dilution: 1.0 ug/ml.

Positive control (+): HepG2 Cell Lysate (HG), Negative control (-): Human Fetal Heart (HE), Antibody concentration: 1 ug/ml.

Liver

WB Suggested Anti-MAP4K4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Small Intestine.