You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb580624 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MAP4K4 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human MAP4K4 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 142kDa |
Target | MAP4K4 |
UniProt ID | O95819 |
Protein Sequence | Synthetic peptide located within the following region: PFIRDQPNERQVRIQLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQ |
NCBI | NP_004825 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | HGK, NIK, MEKKK4, FLH21957, HEL-S-31 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Human Stomach Tumor, Antibody dilution: 1.0 ug/ml.
Positive control (+): HepG2 Cell Lysate (HG), Negative control (-): Human Fetal Heart (HE), Antibody concentration: 1 ug/ml.
Liver
WB Suggested Anti-MAP4K4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Small Intestine.
IF, IHC-Fr, IHC-P, WB | |
Canine, Equine, Gallus, Mouse, Rabbit | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |