You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb388427 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody to MAP3K1 |
Target | MAP3K1 |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a |
Conjugation | Unconjugated |
Reactivity | Human |
Form/Appearance | 200ug/ml of Ab purified from Bioreactor Concentrate by Protein A/G. Prepared in 10mM PBS with 0.05% rAlbumin & 0.05% azide. Also available WITHOUT rAlbumin & azide at 1.0mg/ml. |
Concentration | Purified Ab with BSA and Azide at 200ug/ml |
Buffer/Preservatives | 200ug/ml of Ab Purified from Bioreactor Concentrate by Protein A/G. Prepared in 10mM PBS with 0.05% rAlbumin & 0.05% azide. Also available WITHOUT rAlbumin & azide at 1.0mg/ml. |
Immunogen | Partial recombinant MAP3K1 (aa1077-1176) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK) |
UniProt ID | Q13233 |
MW | 195kDa (intact); 80kDa (cleaved) |
Tested applications | IHC, WB |
Dilution range | FACS: 0.5-1 μg/million cells, IF/ICC: 1-2 μg/ml, WB: 0.5-1 μg/ml, IHC-P: 0.5-1 μg/ml |
Application notes | MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1) |
Clone Number | 2F6 |
Expression System | Bioreactor |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | MEKK1; MEK Kinase 1; MEKK; SRXY6; MAPKKK1 |
Note | For research use only |
Entrez | 4214 |
Immunohistochemical staining of human Uterine Carcinoma tissue using MAP3K1 antibody
Immunohistochemical staining of human Thyroid Carcinoma tissue using MAP3K1 antibody
Immunohistochemical staining of human Cervical Carcinoma tissue using MAP3K1 antibody
ELISA, IHC-P, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
FC, IF, IHC, WB | |
Human | |
Mouse | |
Monoclonal | |
Unconjugated |
FC, IF, IHC, WB | |
Human | |
Mouse | |
Monoclonal | |
Unconjugated |