Cart summary

You have no items in your shopping cart.

Map2k1 Rabbit Polyclonal Antibody

SKU: orb584883

Description

Rabbit polyclonal antibody to Map2k1

Research Area

Cell Biology, Epigenetics & Chromatin, Molecular Biology, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
TargetMap2k1
Protein SequenceSynthetic peptide located within the following region: LIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLNQPSTPTHAA
Molecular Weight43kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Mek1, Prkm, MEKK1, MAPKK1, Prkmk1

Similar Products

  • MEK-1/2 (phospho Ser218/222) rabbit pAb Antibody [orb764230]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl
  • MEK-1 (phospho Thr292) rabbit pAb Antibody [orb769695]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • MEK1/MAP2K1 Rabbit Polyclonal Antibody [orb1098072]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • MEK-1/2 rabbit pAb Antibody [orb765647]

    ELISA,  IF,  IHC,  WB

    Human, Monkey, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl
  • Phospho-MEK1 (Thr386) Rabbit Polyclonal Antibody [orb5175]

    IF,  IHC-Fr,  IHC-P,  WB

    Equine, Gallus, Porcine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Map2k1 Rabbit Polyclonal Antibody

Map2k1 antibody - C-terminal region (orb584883) validated by WB using Mouse Small Intestine Lysate at 1 ug/ml.

Map2k1 Rabbit Polyclonal Antibody

Sample Type: 1. and 2. Human Cystic Fibrosis Bronchial Epithelial Cells (35 ug), Primary dilution: 1:500, Secondary Anitbody: goat anti-rabbit-HRPSecondary dilution: 1:5000.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_032953

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Map2k1 Rabbit Polyclonal Antibody (orb584883)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry