You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb575045 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to MANSC1 |
| Target | MANSC1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Mouse, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human MANSC1 |
| Protein Sequence | Synthetic peptide located within the following region: LTLRLSASQNCLKKSLEDVVIDIQSSLSKGIRGNEPVYTSTQEDCINSCC |
| UniProt ID | Q9H8J5 |
| MW | 47kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | LOH12CR3, 9130403P13Rik |
| Research Area | Epigenetics & Chromatin, Signal Transduction |
| Note | For research use only |
| NCBI | NP_060520 |

Human Lung

WB Suggested Anti-MANSC1 Antibody Titration: 5.0 ug/ml, Positive Control: Fetal kidney lysate.
IHC, WB | |
Bovine, Canine, Equine, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Human, Rat, Sheep | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, ICC, IF, IHC-Fr, IHC-P, WB | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Bovine, Canine, Equine, Human, Rat, Sheep | |
Mouse | |
Rabbit | |
Polyclonal | |
Cy5.5 |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review