You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb585878 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MAGED1 |
Target | MAGED1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Protein Sequence | Synthetic peptide located within the following region: ACFVLEKKFGIQLKEIDKEEHLYILISTPESLAGILGTTKDTPKLGLLLV |
UniProt ID | Q9Y5V3 |
MW | 86kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | NRAGE, DLXIN-1 |
Note | For research use only |
NCBI | NP_008917 |
Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml.
WB Suggested Anti-MAGED1 Antibody, Titration: 1.0 ug/ml, Positive Control: Jurkat Whole Cell. MAGED1 is supported by BioGPS gene expression data to be expressed in Jurkat.
IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-P, WB | |
Porcine | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |