You have no items in your shopping cart.
Cart summary
Item 1 of 1
MAGEA5 Rabbit Polyclonal Antibody
Catalog Number: orb579740
| Catalog Number | orb579740 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to MAGEA5 |
| Target | MAGEA5 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Human |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human MAGEA5 |
| Protein Sequence | Synthetic peptide located within the following region: MSLEQKSQHCKPEEGLDTQEEALGLVGVQAATTEEQEAVSSSSPLVPGTL |
| UniProt ID | P43359 |
| MW | 13 |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | CT1.5, MAGE5, MAGEA4, MAGEA5 |
| Note | For research use only |
| NCBI | NP_066387 |
WB Suggested Anti-MAGEA5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: HT1080 cell lysate. MAGEA5 is supported by BioGPS gene expression data to be expressed in HT1080.
- Item 1 of 3
- Item 1 of 1
Anti-MAGEA5 Antibody [orb1289804]
WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
30 μl, 100 μl, 200 μl - Item 1 of 1
MAGEA5 Rabbit Polyclonal Antibody [orb100179]
IF, IHC-Fr, IHC-P
Human
Rabbit
Polyclonal
Unconjugated
100 μl, 200 μl, 50 μl - Item 1 of 1
- Item 1 of 1
