MAFB Rabbit Polyclonal Antibody

• Catalog Number: orb574782
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MAFB
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MAFB
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 36 kDa
• Target: MAFB
• UniProt ID: Q9Y5Q3
• Protein Sequence: Synthetic peptide located within the following region: MAAELSMGPELPTSPLAMEYVNDFDLLKFDVKKEPLGRAERPGRPCTRLQ
• NCBI: NP_005452
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: KRML, MCTO, DURS3
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The 36 kDa MAFB protein can be modified via sumoylation.

Sample Type: Human Lung, Antibody dilution: 1.0 ug/ml.

Sample Type: Lane 1: Non-overexpressed vector control lysate, Lane 2: Transient overexpression lysate of MAFB, Antibody dilution: 1.0 ug/ml.

Positive control (+): Mouse spleen (M-SP), Negative control (-): Mouse intestine (M-IN), Antibody concentration: 1 ug/ml.

Human kidney

WB Suggested Anti-MAFB Antibody Titration: 1.25 ug/ml, Positive Control: HepG2 cell lysate.