You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb576863 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to LZTR1 |
Target | LZTR1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Protein A purified |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human LZTR1 |
Protein Sequence | Synthetic peptide located within the following region: GFYNNRLQAYCKQNLEMNVTVQNVLQILEAADKTQALDMKRHCLHIIVHQ |
UniProt ID | Q8N653 |
MW | 95kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | NS2, NS10, BTBD29, LZTR-1, SWNTS2 |
Research Area | Epigenetics & Chromatin, Molecular Biology, Stem C Read more... |
Note | For research use only |
NCBI | NP_006758 |
Expiration Date | 12 months from date of receipt. |
Positive control (+): 293T Cell Lysate (2T), Negative control (-): A549 Cell Lysate (N03), Antibody concentration: 5 ug/ml.
WB Suggested Anti-LZTR1 Antibody Titration: 2.5 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat, Sheep, Zebrafish | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |