LYN Rabbit Polyclonal Antibody

• Catalog Number: orb330772
• Category: Antibodies
• Description: Rabbit polyclonal antibody to LYN
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Sheep
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LYN
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 58kDa
• Target: LYN
• UniProt ID: P07948
• Protein Sequence: Synthetic peptide located within the following region: DPTSNKQQRPVPESQLLPGQRFQTKDPEEQGDIVVALYPYDGIHPDDLSF
• NCBI: NP_002341
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti FLJ26625 antibody, anti JTK8 antibody, anti p
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml.

Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml.

Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Rabbit Anti-LYN Antibody, Catalog Number: orb330772, Formalin Fixed Paraffin Embedded Tissue: Human Appendix (Colon) Tissue, Observed Staining: Plasma membrane, Primary Antibody Concentration: 1:600, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-LYN Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Hela cell lysate, LYN is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.