LTC4S Rabbit Polyclonal Antibody

• Catalog Number: orb580627
• Category: Antibodies
• Description: Rabbit polyclonal antibody to LTC4S
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LTC4S
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purity: Affinity Purified
• Conjugation: Unconjugated
• MW: 16kDa
• Target: LTC4S
• UniProt ID: Q16873
• Protein Sequence: Synthetic peptide located within the following region: MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVY
• NCBI: NP_665874
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: MGC33147
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

References

Kotlarczyk, Angelika M. et al. How Is Arachidonic Acid Metabolism in the Uterus Connected with the Immune Status of Red Deer Females (Cervus elaphus L.) in Different Reproductive Stages? Int J Mol Sci, 24, 4771 (2023)

PubMed: 36902199

WB Suggested Anti-LTC4S Antibody, Titration: 1.0 ug/ml, Positive Control: HepG2 Whole Cell.