LTC4S Rabbit Polyclonal Antibody

• Catalog Number: orb580627
• Category: Antibodies
• Description: Rabbit polyclonal antibody to LTC4S
• Target: LTC4S
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purity: Affinity Purified
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LTC4S
• Protein Sequence: Synthetic peptide located within the following region: MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVY
• UniProt ID: Q16873
• MW: 16kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: MGC33147
• Research Area: Cell Biology, Epigenetics & Chromatin, Signal Tran
• Note: For research use only
• NCBI: NP_665874

References

Kotlarczyk, Angelika M. et al. How Is Arachidonic Acid Metabolism in the Uterus Connected with the Immune Status of Red Deer Females (Cervus elaphus L.) in Different Reproductive Stages? Int J Mol Sci, 24, 4771 (2023)

PubMed: 36902199

WB Suggested Anti-LTC4S Antibody, Titration: 1.0 ug/ml, Positive Control: HepG2 Whole Cell.