LTBR Rabbit Polyclonal Antibody

• Catalog Number: orb589771
• Category: Antibodies
• Description: Rabbit polyclonal antibody to LTBR
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human LTBR
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 47 kDa
• Target: LTBR
• UniProt ID: P36941
• Protein Sequence: Synthetic peptide located within the following region: IYNGPVLGGPPGPGDLPATPEPPYPIPEEGDPGPPGLSTPHQEDGKAWHL
• NCBI: NP_001257916.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: TNFCR, TNFR3, D12S370, TNFR-RP, TNFRSF3, TNFR2-RP,
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human HCT15 Whole Cell lysates, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human OVCAR-3 Whole Cell, Antibody Dilution: 1 ug/ml.