LSM5 Rabbit Polyclonal Antibody

• Catalog Number: orb586625
• Category: Antibodies
• Description: Rabbit polyclonal antibody to LSM5
• Target: LSM5
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human LSM5
• Protein Sequence: Synthetic peptide located within the following region: GFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLVPGGEGPEV
• UniProt ID: Q9Y4Y9
• MW: 10kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: YER146W
• Note: For research use only
• NCBI: NP_036454

WB Suggested Anti-LSM5 Antibody, Titration: 1.0 ug/ml, Positive Control: MCF7 Whole Cell. LSM5 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells.