Cart summary

You have no items in your shopping cart.

LSM5 Rabbit Polyclonal Antibody (Biotin)

LSM5 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2089939

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2089939
CategoryAntibodies
DescriptionLSM5 Rabbit Polyclonal Antibody (Biotin)
ClonalityPolyclonal
Species/HostRabbit
ConjugationBiotin
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human LSM5
Protein SequenceSynthetic peptide located within the following region: GFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLVPGGEGPEV
UniProt IDQ9Y4Y9
MW10kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesYER146W
NoteFor research use only
NCBINP_036454
  • LSM5 Rabbit Polyclonal Antibody (Biotin) [orb451262]

    ELISA,  ICC,  IF,  IHC-Fr,  IHC-P

    Human, Mouse, Porcine, Rat

    Rabbit

    Polyclonal

    Biotin

    100 μl