Cart summary

You have no items in your shopping cart.

LSM4 Rabbit Polyclonal Antibody (HRP)

LSM4 Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2124998

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2124998
CategoryAntibodies
DescriptionLSM4 Rabbit Polyclonal Antibody (HRP)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsIHC, WB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human LSM4
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ConjugationHRP
MW15kDa
UniProt IDQ9Y4Z0
Protein SequenceSynthetic peptide located within the following region: GRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGK
NCBINP_036453
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Alternative namesGRP, YER112W
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.