Cart summary

You have no items in your shopping cart.

LRRC75B Rabbit Polyclonal Antibody

Catalog Number: orb582977

Select Product Size
SizePriceQuantity
100 μl$ 600.00
100 μl Enquire
DispatchUsually dispatched within 3-7 working days
Product Properties
Catalog Numberorb582977
CategoryAntibodies
DescriptionRabbit polyclonal antibody to LRRC75B
TargetLRRC75B
ClonalityPolyclonal
Species/HostRabbit
ConjugationUnconjugated
ReactivityHuman
Predicted ReactivityRat
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
PurificationAffinity Purified
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human C22orf36
Protein SequenceSynthetic peptide located within the following region: WKSSDKICRQLIYHLTPHSKQQQGSSLRQRKTQSCLKSSLQKTLLAGETV
UniProt IDQ2VPJ9
MW35kDa
Tested applicationsWB
StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Alternative namesFAM211B, C22orf36
NoteFor research use only
NCBINP_997527
Images
LRRC75B Rabbit Polyclonal Antibody

WB Suggested Anti-C22orf36 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 721_B cell lysate. FAM211B is supported by BioGPS gene expression data to be expressed in 721_B.

Similar Products
Reviews

LRRC75B Rabbit Polyclonal Antibody (orb582977)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet