Cart summary

You have no items in your shopping cart.

Lrrc40 Rabbit Polyclonal Antibody (HRP)

Lrrc40 Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2102312

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2102312
CategoryAntibodies
DescriptionLrrc40 Rabbit Polyclonal Antibody (HRP)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ConjugationHRP
MW68kDa
UniProt IDQ9CRC8
Protein SequenceSynthetic peptide located within the following region: VLYRISTLEAVLISNNQVGSVDPQKMKLMENLNTLDLQNNDLLQIPPELG
NCBINP_077156
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Alternative namesAI837674, 2610040E16Rik
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.