Cart summary

You have no items in your shopping cart.

Lrrc3b Rabbit Polyclonal Antibody (FITC)

Lrrc3b Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2111970

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2111970
CategoryAntibodies
DescriptionLrrc3b Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Rat Lrrc3b
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW29kDa
UniProt IDD4A9I7
Protein SequenceSynthetic peptide located within the following region: MASNHETAHNVICKTSVLDEHAGRPFLNAANDADLCNLPKKTTDYAMLVT
NCBIXP_002725082
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesRGD1311897
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.