Cart summary

You have no items in your shopping cart.

LRRC26 Rabbit Polyclonal Antibody (FITC)

LRRC26 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2118909

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2118909
CategoryAntibodies
DescriptionLRRC26 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human LRRC26
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW37kDa
UniProt IDQ2I0M4
Protein SequenceSynthetic peptide located within the following region: LRPLCAWLRRHPLPASEAETVLCVWPGRLTLSPLTAFSDAAFSHCAQPLA
NCBINP_001013675
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesCAPC, bA350O14.10
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.