Cart summary

You have no items in your shopping cart.

LRIT3 Rabbit Polyclonal Antibody (FITC)

LRIT3 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2085960

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2085960
CategoryAntibodies
DescriptionLRIT3 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Rabbit
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human LRIT3
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW69kDa
UniProt IDQ3SXY7
Protein SequenceSynthetic peptide located within the following region: TVIQESPEEGVRWSIMSLTGISSKDAGDYKCKAKNLAGMSEAVVTVTVLG
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesCSNB1F, FIGLER4
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.