C1orf103 Rabbit Polyclonal Antibody

• Catalog Number: orb583040
• Category: Antibodies
• Description: Rabbit polyclonal antibody to C1orf103
• Target: LRIF1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Canine, Equine, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C1orf103
• Protein Sequence: Synthetic peptide located within the following region: SHSKTRQEKRTEMEYYTHEKQEKGTLNSNAAYEQSHFFNKNYTEDIFPVT
• UniProt ID: Q5T3J3
• MW: 85 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: RIF1, HBiX1, C1orf103
• Research Area: Epigenetics & Chromatin
• Note: For research use only
• NCBI: NP_060842

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The 85 kDa and 27 kDa isoforms contain the peptide sequence. Protein may be phosphorylated and/or modified.

Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. LRIF1 is supported by BioGPS gene expression data to be expressed in 721_B.

WB Suggested Anti-C1orf103 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate. LRIF1 is supported by BioGPS gene expression data to be expressed in HepG2.